2oo9/2/1:C/2:C

Sequences
>2oo9-a2-m1-cC (length=39) [Search sequence]
SSEIENLSQGYSYQDIQKALVIAQNNIEAKNILREFAAA
>2oo9-a2-m2-cC (length=39) [Search sequence]
SSEIENLSQGYSYQDIQKALVIAQNNIEAKNILREFAAA
Structure information
PDB ID 2oo9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title crystal structure of the UBA domain from human c-Cbl ubiquitin ligase
Assembly ID 2
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C C
UniProt accession P22681 P22681
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2oo9-a2-m1-cC_2oo9-a2-m2-cC.pdb.gz
Full biological assembly
Download: 2oo9-assembly2.cif.gz
Similar dimers

[Back to Home]