2oqq/2/2:A/2:B

Sequences

>2oqq-a2-m2-cA (length=42) [Search sequence]

GSAYLSELENRVKDLENKNSELEERLSTLQNENQMLRHILKN

>2oqq-a2-m2-cB (length=42) [Search sequence]

GSAYLSELENRVKDLENKNSELEERLSTLQNENQMLRHILKN

Structure information

PDB ID	2oqq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of HY5 leucine zipper homodimer from Arabidopsis thaliana
Assembly ID	2
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	53
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	B
UniProt accession	O24646	O24646
Species	3702 (Arabidopsis thaliana)	3702 (Arabidopsis thaliana)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2oqq-a2-m2-cA_2oqq-a2-m2-cB.pdb.gz

Full biological assembly Download: 2oqq-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2oqq/1/1:A/1:B 2oqq/2/1:A/1:B