2ota/1/1:B/1:A

Sequences
>2ota-a1-m1-cB (length=60) [Search sequence]
NERVEKIIQDLLDVLVKEEVTPDLALCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVL
>2ota-a1-m1-cA (length=66) [Search sequence]
YSNERVEKIIQDLLDVLVKEEVTPDLALCLGNAVTNIIAQVPESKRVAVVDNFTKALKQS
VLEHHH
Structure information
PDB ID 2ota (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the UPF0352 protein CPS_2611 from Colwellia psychrerythraea. NESG target CsR4.
Assembly ID 1
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 135
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q481E4 Q481E4
Species 167879 (Colwellia psychrerythraea 34H) 167879 (Colwellia psychrerythraea 34H)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ota-a1-m1-cB_2ota-a1-m1-cA.pdb.gz
Full biological assembly
Download: 2ota-assembly1.cif.gz
Similar dimers

[Back to Home]