2ovc/1/2:A/4:A

Sequences
>2ovc-a1-m2-cA (length=30) [Search sequence]
DEISMMGRVVKVEKQVQSIEHKLDLLLGFY
>2ovc-a1-m4-cA (length=30) [Search sequence]
DEISMMGRVVKVEKQVQSIEHKLDLLLGFY
Structure information
PDB ID 2ovc (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a coiled-coil tetramerization domain from Kv7.4 channels
Assembly ID 1
Resolution 2.07Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 36
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID A A
UniProt accession P56696 P56696
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ovc-a1-m2-cA_2ovc-a1-m4-cA.pdb.gz
Full biological assembly
Download: 2ovc-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2ovc/1/1:A/3:A 2ovc/1/1:A/4:A 2ovc/1/2:A/3:A

[Back to Home]