2p04/1/1:B/1:A

Sequences
>2p04-a1-m1-cB (length=105) [Search sequence]
MAPPHLTLSPELLAKAFPFHFAFSRNREIVQTGEVLERISPEPLVGKLIEQHFQINRPKI
LIDFDAISKQPRALFILEFLHNGMQLKGQMMYQPEEEVIFFLGSP
>2p04-a1-m1-cA (length=107) [Search sequence]
MAPPHLTLSPELLAKAFPFHFAFSRNREIVQTGEVLERISPEPLVGKLIEQHFQINRPKI
LIDFDAISKQPRALFILEFLHNGMQLKGQMMYQPEEEVIFFLGSPWI
Structure information
PDB ID 2p04 (database links: RCSB PDB PDBe PDBj PDBsum)
Title 2.1 Ang structure of the dimerized PAS domain of signal transduction histidine kinase from Nostoc punctiforme PCC 73102 with homology to the H-NOXA/H-NOBA domain of the soluble guanylyl cyclase
Assembly ID 1
Resolution 2.11Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 75
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession D0VWX5 D0VWX5
Species 63737 (Nostoc punctiforme PCC 73102) 63737 (Nostoc punctiforme PCC 73102)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2p04-a1-m1-cB_2p04-a1-m1-cA.pdb.gz
Full biological assembly
Download: 2p04-assembly1.cif.gz

[Back to Home]