2p0g/1/1:C/1:D

Sequences
>2p0g-a1-m1-cC (length=79) [Search sequence]
NKAQIEIYYCRQCNWLRSAWLSQELLHTFSEEIEYVALHPDTGGRFEIFCNGVQIWERKQ
EGGFPEAKVLKQRVRDLID
>2p0g-a1-m1-cD (length=79) [Search sequence]
KAQIEIYYCRQCNWLRSAWLSQELLHTFSEEIEYVALHPDTGGRFEIFCNGVQIWERKQE
GGFPEAKVLKQRVRDLIDP
Structure information
PDB ID 2p0g (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Selenoprotein W-related protein from Vibrio cholerae. Northeast Structural Genomics target VcR75
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 46
Sequence identity between the two chains 0.987
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q9KTC1 Q9KTC1
Species 666 (Vibrio cholerae) 666 (Vibrio cholerae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2p0g-a1-m1-cC_2p0g-a1-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2p0g-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2p0g/1/1:A/1:D 2p0g/1/1:B/1:C
  • [Back to Home]