2p32/7/1:E/1:F

Sequences

>2p32-a7-m1-cE (length=82) [Search sequence]

GLVPRGSHMGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEE FEHQQKDLEGLANPIISKLYQS

>2p32-a7-m1-cF (length=82) [Search sequence]

GLVPRGSHMGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEE FEHQQKDLEGLANPIISKLYQS

Structure information

PDB ID	2p32 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the C-terminal 10 kDa subdomain from C. elegans Hsp70
Assembly ID	7
Resolution	3.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	16
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	F
UniProt accession	P09446	P09446
Species	6239 (Caenorhabditis elegans)	6239 (Caenorhabditis elegans)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2p32-a7-m1-cE_2p32-a7-m1-cF.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2p32-assembly7.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2p32/7/1:A/1:B 2p32/7/1:A/1:C 2p32/7/1:B/1:C 2p32/7/1:D/1:E 2p32/7/1:D/1:F
Other dimers with similar sequences but different poses	2p32/7/1:A/1:F 2p32/7/1:B/1:E 2p32/7/1:C/1:D