2p4p/1/1:B/1:A

Sequences
>2p4p-a1-m1-cB (length=66) [Search sequence]
DSWLIDGATPLEDVRALNIHTFPRDENYETIGGFYLRIPTDFVLYDYFEIIDTENFRIDQ
LVSFRD
>2p4p-a1-m1-cA (length=72) [Search sequence]
NARRNEDSWLIDGATPLEDVRALNIHTFPRDENYETIGGFYLRIPTDFVLYDYFEIIDTE
NFRIDQLVSFRD
Structure information
PDB ID 2p4p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a CorC_HlyC domain from Haemophilus ducreyi
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q7VKS4 Q7VKS4
Species 233412 ([Haemophilus] ducreyi 35000HP) 233412 ([Haemophilus] ducreyi 35000HP)
Function annotation BioLiP:2p4pB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2p4p-a1-m1-cB_2p4p-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2p4p-assembly1.cif.gz

[Back to Home]