2p4r/2/1:A/2:A

Sequences
>2p4r-a2-m1-cA (length=55) [Search sequence]
SVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
>2p4r-a2-m2-cA (length=55) [Search sequence]
SVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
Structure information
PDB ID 2p4r (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural basis for a novel interaction between AIP4 and beta-PIX
Assembly ID 2
Resolution 2.001Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
PubMed citation 17652093
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession O55043 O55043
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
Function annotation BioLiP:2p4rA BioLiP:2p4rA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2p4r-a2-m1-cA_2p4r-a2-m2-cA.pdb.gz
Full biological assembly
Download: 2p4r-assembly2.cif.gz

[Back to Home]