2p5t/3/1:G/1:E

Sequences

>2p5t-a3-m1-cG (length=93) [Search sequence]

MLNPVEDYELTLKIEIVKERGANLLSRLYRYQDSQGISIDDESNPWILMSDDLSDLIHTN IYLVETFDEIERYSGYLDGIERMLEISEKRMVA

>2p5t-a3-m1-cE (length=95) [Search sequence]

DKMLNPVEDYELTLKIEIVKERGANLLSRLYRYQDSQGISIDDESNPWILMSDDLSDLIH TNIYLVETFDEIERYSGYLDGIERMLEISEKRMVA

Structure information

PDB ID	2p5t (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Molecular and structural characterization of the PezAT chromosomal toxin-antitoxin system of the human pathogen Streptococcus pneumoniae
Assembly ID	3
Resolution	3.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	53
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	E
UniProt accession	Q97QZ2	Q97QZ2
Species	170187 (Streptococcus pneumoniae TIGR4)	170187 (Streptococcus pneumoniae TIGR4)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2p5t-a3-m1-cG_2p5t-a3-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2p5t-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2p5t/1/1:A/1:C 2p5t/2/1:G/1:E