2p5v/1/1:A/1:B

Sequences
>2p5v-a1-m1-cA (length=155) [Search sequence]
QLTLDKTDIKILQVLQENGRLTNVELSERVALSPSPCLRRLKQLEDAGIVRQYAALLSPE
SVNLGLQAFIRVSIRKAKDAREDFAASVRKWPEVLSCFALTGETDYLLQAFFTDNAFSHF
VLDTLLSHHGVQDAQSSFVLKEIKHTTSLPLNHLL
>2p5v-a1-m1-cB (length=155) [Search sequence]
QLTLDKTDIKILQVLQENGRLTNVELSERVALSPSPCLRRLKQLEDAGIVRQYAALLSPE
SVNLGLQAFIRVSIRKAKDAREDFAASVRKWPEVLSCFALTGETDYLLQAFFTDNAFSHF
VLDTLLSHHGVQDAQSSFVLKEIKHTTSLPLNHLL
Structure information
PDB ID 2p5v (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Transcriptional Regulator NMB0573 from Neisseria Meningitidis
Assembly ID 1
Resolution 1.99Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 220
Sequence identity between the two chains 1.0
PubMed citation 17374605
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q9K0L9 Q9K0L9
Species 122586 (Neisseria meningitidis MC58) 122586 (Neisseria meningitidis MC58)
Function annotation BioLiP:2p5vA BioLiP:2p5vB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2p5v-a1-m1-cA_2p5v-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2p5v-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2p5v/1/1:C/1:D 2p5v/1/1:F/1:E 2p5v/1/1:H/1:G 2p6s/1/1:A/1:B 2p6s/1/1:C/1:D 2p6s/1/1:F/1:E 2p6s/1/1:H/1:G 2p6t/1/1:A/1:B 2p6t/1/1:C/1:D 2p6t/1/1:E/1:F 2p6t/1/1:H/1:G
Other dimers with similar sequences but different poses
  • 2p5v/1/1:C/1:F 2p5v/1/1:A/1:D 2p5v/1/1:B/1:G 2p5v/1/1:H/1:E 2p6s/1/1:A/1:D 2p6s/1/1:B/1:G 2p6s/1/1:C/1:F 2p6s/1/1:H/1:E 2p6t/1/1:A/1:D 2p6t/1/1:B/1:G 2p6t/1/1:C/1:F 2p6t/1/1:E/1:H
  • 2p6s/1/1:F/1:H 2p5v/1/1:A/1:G 2p5v/1/1:B/1:D 2p5v/1/1:C/1:A 2p5v/1/1:C/1:E 2p5v/1/1:E/1:G 2p5v/1/1:F/1:D 2p5v/1/1:F/1:H 2p5v/1/1:H/1:B 2p6s/1/1:A/1:G 2p6s/1/1:B/1:D 2p6s/1/1:C/1:A 2p6s/1/1:C/1:E 2p6s/1/1:E/1:G 2p6s/1/1:F/1:D 2p6s/1/1:H/1:B 2p6t/1/1:A/1:G 2p6t/1/1:C/1:A 2p6t/1/1:C/1:E 2p6t/1/1:D/1:B 2p6t/1/1:E/1:G 2p6t/1/1:F/1:D 2p6t/1/1:H/1:B 2p6t/1/1:H/1:F
  • [Back to Home]