2p63/3/1:B/1:A

Sequences
>2p63-a3-m1-cB (length=50) [Search sequence]
SPEYLSDEIFSAINNNLPHAYFKNLLFRLVANDRSELSDLGTLIKDNLKR
>2p63-a3-m1-cA (length=51) [Search sequence]
GSPEYLSDEIFSAINNNLPHAYFKNLLFRLVANDRSELSDLGTLIKDNLKR
Structure information
PDB ID 2p63 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Suprafacial orientation of the SCFCdc4 dimer accommodates multiple geometries for substrate ubiquitination
Assembly ID 3
Resolution 2.67Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 69
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P07834 P07834
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2p63-a3-m1-cB_2p63-a3-m1-cA.pdb.gz
Full biological assembly
Download: 2p63-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2p63/1/1:B/1:A 2p63/1/1:D/1:C 2p63/2/1:D/1:C

[Back to Home]