2p64/1/1:A/1:B

Sequences
>2p64-a1-m1-cA (length=49) [Search sequence]
AASYEKEKELCVKYFEQWSESDQVEFVEHLISQCHYQHGHINSYLKPLQ
>2p64-a1-m1-cB (length=50) [Search sequence]
GAASYEKEKELCVKYFEQWSESDQVEFVEHLISQCHYQHGHINSYLKPLQ
Structure information
PDB ID 2p64 (database links: RCSB PDB PDBe PDBj PDBsum)
Title D domain of b-TrCP
Assembly ID 1
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 94
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q9Y297 Q9Y297
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2p64-a1-m1-cA_2p64-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2p64-assembly1.cif.gz

[Back to Home]