2p6v/1/3:A/6:A

Sequences
>2p6v-a1-m3-cA (length=89) [Search sequence]
SSAATETMENVCNFLSTLILASSGQSTETAANVELVQNLLDGIEAEDFTSRLYRELNSSP
QPYLVPFLRSLPALRQLTPDSAAFIQQSQ
>2p6v-a1-m6-cA (length=89) [Search sequence]
SSAATETMENVCNFLSTLILASSGQSTETAANVELVQNLLDGIEAEDFTSRLYRELNSSP
QPYLVPFLRSLPALRQLTPDSAAFIQQSQ
Structure information
PDB ID 2p6v (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of TAFH domain of the human TAF4 subunit of TFIID
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 16
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 6
Chain ID A A
UniProt accession O00268 O00268
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2p6v-a1-m3-cA_2p6v-a1-m6-cA.pdb.gz
Full biological assembly
Download: 2p6v-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2p6v/1/1:A/5:A 2p6v/1/2:A/4:A
Other dimers with similar sequences but different poses
  • 2p6v/1/5:A/6:A 2p6v/1/1:A/2:A 2p6v/1/1:A/3:A 2p6v/1/2:A/3:A 2p6v/1/4:A/5:A 2p6v/1/4:A/6:A
  • [Back to Home]