2p9x/1/1:B/1:D

Sequences

>2p9x-a1-m1-cB (length=95) [Search sequence]

KGRDILTKTIILALREVAPGLEAVLEAHLRATLNSGIELAYDDPQKFKEAVSKLFGEYSA RLLEMVIISKLKGRLGIEANSLEELVSEIRKIYGE

>2p9x-a1-m1-cD (length=98) [Search sequence]

SKGRDILTKTIILALREVAPGLEAVLEAHLRATLNSGIELAYDDPQKFKEAVSKLFGEYS ARLLEMVIISKLKGRLGEDIEANSLEELVSEIRKIYGE

Structure information

PDB ID	2p9x (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of PH0832 from Pyrococcus horikoshii OT3
Assembly ID	1
Resolution	1.65Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	34
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	O58562	O58562
Species	70601 (Pyrococcus horikoshii OT3)	70601 (Pyrococcus horikoshii OT3)
Function annotation	BioLiP:2p9xD

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2p9x-a1-m1-cB_2p9x-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2p9x-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

2p9x/2/2:B/2:C 2p9x/1/1:A/1:D 2p9x/1/1:B/1:C 2p9x/2/1:A/1:D 2p9x/1/1:C/1:D 2p9x/1/1:B/1:A