2pd1/5/3:D/1:A

Sequences

>2pd1-a5-m3-cD (length=99) [Search sequence]

TKLALFVRLEAKPGQEAALADFLASALPLANAESGTTAWFALKFGPSTFGVFDAFADEAG RQAHLNGQIAAALANAATLLSSPPNIEKVELLAAKLPAG

>2pd1-a5-m1-cA (length=101) [Search sequence]

GHTKLALFVRLEAKPGQEAALADFLASALPLANAESGTTAWFALKFGPSTFGVFDAFADE AGRQAHLNGQIAAALANAATLLSSPPNIEKVELLAAKLPAG

Structure information

PDB ID	2pd1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of NE2512 protein of unknown function from Nitrosomonas europaea
Assembly ID	5
Resolution	1.86Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	28
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	3	1
Chain ID	D	A
UniProt accession	Q82S47	Q82S47
Species	915 (Nitrosomonas europaea)	915 (Nitrosomonas europaea)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2pd1-a5-m3-cD_2pd1-a5-m1-cA.pdb.gz

Full biological assembly Download: 2pd1-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2pd1/3/3:D/1:A 2pd1/3/4:D/2:A 2pd1/4/1:B/1:C
Other dimers with similar sequences but different poses	2pd1/5/3:B/3:D 2pd1/1/1:C/1:A 2pd1/2/1:B/1:D 2pd1/3/1:C/1:A 2pd1/3/2:C/2:A 2pd1/3/3:B/3:D 2pd1/3/4:B/4:D 2pd1/4/1:B/1:D 2pd1/4/1:C/1:A 2pd1/5/1:C/1:A