2pd2/2/4:B/5:B

Sequences
>2pd2-a2-m4-cB (length=108) [Search sequence]
MKVVVQIKDFDKVPQALRSVINLYNDIKDAEIEVVLHQSAIKALLKDSDTRSIIEDLIKK
NILIVGCENSIRSQNLSHDQLIPGIKIVTSGVGEIVRKQSEGWIYLAL
>2pd2-a2-m5-cB (length=108) [Search sequence]
MKVVVQIKDFDKVPQALRSVINLYNDIKDAEIEVVLHQSAIKALLKDSDTRSIIEDLIKK
NILIVGCENSIRSQNLSHDQLIPGIKIVTSGVGEIVRKQSEGWIYLAL
Structure information
PDB ID 2pd2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of (ST0148) conserved hypothetical from Sulfolobus Tokodaii Strain7
Assembly ID 2
Resolution 2.06Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 5
Chain ID B B
UniProt accession Q976P3 Q976P3
Species 273063 (Sulfurisphaera tokodaii str. 7) 273063 (Sulfurisphaera tokodaii str. 7)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2pd2-a2-m4-cB_2pd2-a2-m5-cB.pdb.gz
Full biological assembly
Download: 2pd2-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2pd2/1/1:A/2:A 2pd2/1/1:A/3:A 2pd2/1/2:A/3:A 2pd2/2/1:B/4:B 2pd2/2/1:B/5:B

[Back to Home]