2peh/3/1:A/2:B

Sequences
>2peh-a3-m1-cA (length=104) [Search sequence]
AMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFL
EFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV
>2peh-a3-m2-cB (length=104) [Search sequence]
AMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFL
EFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV
Structure information
PDB ID 2peh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the UHM domain of human SPF45 in complex with SF3b155-ULM5
Assembly ID 3
Resolution 2.11Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
PubMed citation 17589525
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession Q96I25 Q96I25
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:2pehA BioLiP:2pehB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2peh-a3-m1-cA_2peh-a3-m2-cB.pdb.gz
Full biological assembly
Download: 2peh-assembly3.cif.gz

[Back to Home]