2pg1/3/1:F/1:G

Sequences
>2pg1-a3-m1-cF (length=100) [Search sequence]
QFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAIQK
NGAGLHTASSCYWNNDTDGSCTVRWENKTYCIVSVFGLAV
>2pg1-a3-m1-cG (length=101) [Search sequence]
SQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAIQ
KNGAGLHTASSCYWNNDTDGSCTVRWENKTYCIVSVFGLAV
Structure information
PDB ID 2pg1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural analysis of a cytoplasmic dynein Light Chain-Intermediate Chain complex
Assembly ID 3
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 117
Sequence identity between the two chains 1.0
PubMed citation 17551010
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F G
UniProt accession Q94524 Q94524
Species 7227 (Drosophila melanogaster) 7227 (Drosophila melanogaster)
Function annotation BioLiP:2pg1F BioLiP:2pg1G
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2pg1-a3-m1-cF_2pg1-a3-m1-cG.pdb.gz
Full biological assembly
Download: 2pg1-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1ygt/1/1:A/2:A 2pg1/1/1:F/1:G 2pg1/2/1:H/1:E 2pg1/3/1:H/1:E 3fm7/1/1:A/1:B

[Back to Home]