2pg4/4/4:A/4:B

Sequences

>2pg4-a4-m4-cA (length=90) [Search sequence]

DDETLRLQFGHLIRILPTLLEFEKKGYEPSLAEIVKASGVSEKTFFGLKDRLIRAGLVKE ETLSYRVKTLKLTEKGRRLAECLEKCRDVL

>2pg4-a4-m4-cB (length=90) [Search sequence]

DETLRLQFGHLIRILPTLLEFEKKGYEPSLAEIVKASGVSEKTFFGLKDRLIRAGLVKEE TLSYRVKTLKLTEKGRRLAECLEKCRDVLG

Structure information

PDB ID	2pg4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a putative dna binding protein (ape_0880a) from aeropyrum pernix k1 at 2.21 A resolution
Assembly ID	4
Resolution	2.21Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	58
Sequence identity between the two chains	0.989

Chain information

	Chain 1	Chain 2
Model ID	4	4
Chain ID	A	B
UniProt accession	Q9YDN4	Q9YDN4
Species	272557 (Aeropyrum pernix K1)	272557 (Aeropyrum pernix K1)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2pg4-a4-m4-cA_2pg4-a4-m4-cB.pdb.gz

Full biological assembly Download: 2pg4-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2pg4/1/1:A/1:B 2pg4/2/1:A/1:B 2pg4/2/2:A/2:B 2pg4/3/1:A/1:B 2pg4/3/3:A/3:B 2pg4/4/1:A/1:B