2pg4/4/4:A/4:B

Sequences
>2pg4-a4-m4-cA (length=90) [Search sequence]
DDETLRLQFGHLIRILPTLLEFEKKGYEPSLAEIVKASGVSEKTFFGLKDRLIRAGLVKE
ETLSYRVKTLKLTEKGRRLAECLEKCRDVL
>2pg4-a4-m4-cB (length=90) [Search sequence]
DETLRLQFGHLIRILPTLLEFEKKGYEPSLAEIVKASGVSEKTFFGLKDRLIRAGLVKEE
TLSYRVKTLKLTEKGRRLAECLEKCRDVLG
Structure information
PDB ID 2pg4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a putative dna binding protein (ape_0880a) from aeropyrum pernix k1 at 2.21 A resolution
Assembly ID 4
Resolution 2.21Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 58
Sequence identity between the two chains 0.989
Chain information
Chain 1 Chain 2
Model ID 4 4
Chain ID A B
UniProt accession Q9YDN4 Q9YDN4
Species 272557 (Aeropyrum pernix K1) 272557 (Aeropyrum pernix K1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2pg4-a4-m4-cA_2pg4-a4-m4-cB.pdb.gz
Full biological assembly
Download: 2pg4-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2pg4/1/1:A/1:B 2pg4/2/1:A/1:B 2pg4/2/2:A/2:B 2pg4/3/1:A/1:B 2pg4/3/3:A/3:B 2pg4/4/1:A/1:B

[Back to Home]