2pij/1/1:A/1:B

Sequences

>2pij-a1-m1-cA (length=57) [Search sequence]

KKIPLSKYLEEHGTQSALAAALGVNQSAISQVRAGRSIEITLYEDGRVEANEIRPIP

>2pij-a1-m1-cB (length=58) [Search sequence]

KKIPLSKYLEEHGTQSALAAALGVNQSAISQVRAGRSIEITLYEDGRVEANEIRPIPA

Structure information

PDB ID	2pij (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the Cro protein from prophage Pfl 6 in Pseudomonas fluorescens Pf-5
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	41
Sequence identity between the two chains	1.0
PubMed citation	18227506

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	J3IU59	J3IU59
Species	220664 (Pseudomonas protegens Pf-5)	220664 (Pseudomonas protegens Pf-5)
Function annotation	BioLiP:2pijA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2pij-a1-m1-cA_2pij-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2pij-assembly1.cif.gz