2pkh/2/1:E/1:H

Sequences
>2pkh-a2-m1-cE (length=140) [Search sequence]
HRHTCKVVLKEEAAGSERALALDREGQRVFHSLIVHFENDIPVQIEDRFVNAQVAPDYLK
QDFTLQTPYAYLSQVAPLTEGEHVVEAILAEADECKLLQIDAGEPCLLIRRRTWSGRQPV
TAARLIHPGSRHRLEGRFTK
>2pkh-a2-m1-cH (length=140) [Search sequence]
HRHTCKVVLKEEAAGSERALALDREGQRVFHSLIVHFENDIPVQIEDRFVNAQVAPDYLK
QDFTLQTPYAYLSQVAPLTEGEHVVEAILAEADECKLLQIDAGEPCLLIRRRTWSGRQPV
TAARLIHPGSRHRLEGRFTK
Structure information
PDB ID 2pkh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural Genomics, the crystal structure of the C-terminal domain of histidine utilization repressor from Pseudomonas syringae pv. tomato str. DC3000
Assembly ID 2
Resolution 1.95Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 17
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E H
UniProt accession Q87UX0 Q87UX0
Species 223283 (Pseudomonas syringae pv. tomato str. DC3000) 223283 (Pseudomonas syringae pv. tomato str. DC3000)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2pkh-a2-m1-cE_2pkh-a2-m1-cH.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2pkh-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2pkh/1/1:A/1:D 2pkh/1/1:B/1:C 2pkh/2/1:F/1:G
Other dimers with similar sequences but different poses
  • 2pkh/2/1:G/1:H 2pkh/1/1:A/1:B 2pkh/1/1:D/1:C 2pkh/2/1:F/1:E
  • 2pkh/2/1:G/1:E 2pkh/1/1:A/1:C
  • 2pkh/2/1:F/1:H 2pkh/1/1:D/1:B
    		•

    [Back to Home]