2pli/1/1:B/1:A

Sequences

>2pli-a1-m1-cB (length=81) [Search sequence]

ADNIHAVSSERWRIHAATEIEDINTFFGTEYSSEEADTIGGLVIQELGHLPVRGEKVLIG GLQFTVARADNRRLHTLATRV

>2pli-a1-m1-cA (length=83) [Search sequence]

SADNIHAVSSERWRIHAATEIEDINTFFGTEYSSEEADTIGGLVIQELGHLPVRGEKVLI GGLQFTVARADNRRLHTLATRVK

Structure information

PDB ID	2pli (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of putative Mg2+ and Co2+ transporter(CorC)associated region from Neisseria meningitidis MC58
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	18
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q9K0P8	Q9K0P8
Species	122586 (Neisseria meningitidis MC58)	122586 (Neisseria meningitidis MC58)
Function annotation	BioLiP:2pliB	BioLiP:2pliA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2pli-a1-m1-cB_2pli-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2pli-assembly1.cif.gz