2pls/6/1:L/2:L

Sequences

>2pls-a6-m1-cL (length=83) [Search sequence]

SNAVQREDGSWLLDGLIAVPELKDTLGLRAVPEEEKGVYHTLSGIWLLGRLPQTGDITFW ENWRLEVIDDSKRIDKVLATKID

>2pls-a6-m2-cL (length=83) [Search sequence]

SNAVQREDGSWLLDGLIAVPELKDTLGLRAVPEEEKGVYHTLSGIWLLGRLPQTGDITFW ENWRLEVIDDSKRIDKVLATKID

Structure information

PDB ID	2pls (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural Genomics, the crystal structure of the CorC/HlyC transporter associated domain of a CBS domain protein from Chlorobium tepidum TLS
Assembly ID	6
Resolution	2.15Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	23
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	L	L
UniProt accession	Q8KEZ1	Q8KEZ1
Species	194439 (Chlorobaculum tepidum TLS)	194439 (Chlorobaculum tepidum TLS)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2pls-a6-m1-cL_2pls-a6-m2-cL.pdb.gz

Full biological assembly Download: 2pls-assembly6.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2pls/3/1:G/1:H 2pls/4/1:I/1:J 2pls/5/1:K/2:K
Other dimers with similar sequences but different poses	2pls/1/1:B/1:C 2pls/1/1:A/1:B 2pls/1/1:A/1:C 2pls/2/1:D/1:E 2pls/2/1:D/1:F 2pls/2/1:E/1:F