2pnv/3/7:B/8:B

Sequences
>2pnv-a3-m7-cB (length=39) [Search sequence]
NIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALP
>2pnv-a3-m8-cB (length=39) [Search sequence]
NIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALP
Structure information
PDB ID 2pnv (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the leucine zipper domain of small-conductance Ca2+-activated K+ (SKCa) channel from Rattus norvegicus
Assembly ID 3
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 7 8
Chain ID B B
UniProt accession P70604 P70604
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2pnv-a3-m7-cB_2pnv-a3-m8-cB.pdb.gz
Full biological assembly
Download: 2pnv-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2pnv/1/1:A/2:A 2pnv/1/1:A/3:A 2pnv/1/2:A/3:A 2pnv/2/1:B/4:B 2pnv/2/1:B/5:B 2pnv/2/4:B/5:B 2pnv/3/1:A/2:A 2pnv/3/1:A/3:A 2pnv/3/2:A/3:A 2pnv/3/6:B/7:B 2pnv/3/6:B/8:B

[Back to Home]