2poc/1/1:B/1:C

Sequences

>2poc-a1-m1-cB (length=352) [Search sequence]

PYKHFMQKEIFEQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYH
SCLATRSIFEELTEIPVSVELASDFLDRRSPVFRDDTCVFVSQSGETADSILALQYCLER
GALTVGIVNSVGSSMSRQTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSNDSISR
KGRHEEIIKGLQKIPEQIKQVLKLENKIKDLCNSSLNDQKSLLLLGRGYQFATALEGALK
IKEISYMHSEGVLAGELKHGILALVDEDLPIIAFATRDSLFPKVMSAIEQVTARDGRPIV
ICNEGDAIISNDKVHTTLEVPETVDCLQGLLNVIPLQLISYWLAVNRGIDVD

>2poc-a1-m1-cC (length=352) [Search sequence]

Structure information

PDB ID	2poc (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from Candida albicans
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	14
Sequence identity between the two chains	1.0
PubMed citation	17681543

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	P53704	P53704
Species	237561 (Candida albicans SC5314)	237561 (Candida albicans SC5314)
Function annotation	BioLiP:2pocB	BioLiP:2pocC

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2poc-a1-m1-cB_2poc-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2poc-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2poc/1/1:A/1:D 2put/1/1:A/1:D 2put/1/1:C/1:B 2puv/1/1:A/1:D 2puv/1/1:C/1:B 2puw/1/1:B/2:A 2puw/1/2:B/1:A
Other dimers with similar sequences but different poses	2poc/1/1:D/1:C 2poc/1/1:A/1:B 2put/1/1:A/1:B 2put/1/1:D/1:C 2puv/1/1:A/1:B 2puv/1/1:D/1:C 2puw/1/1:B/1:A 2puw/1/2:B/2:A 2poc/1/1:A/1:C 2poc/1/1:D/1:B 2put/1/1:A/1:C 2put/1/1:D/1:B 2puv/1/1:A/1:C 2puv/1/1:D/1:B 2puw/1/1:A/2:A 2puw/1/1:B/2:B