2ppx/1/2:A/4:A

Sequences
>2ppx-a1-m2-cA (length=61) [Search sequence]
PRIKIIRRALKLTQEEFSARYHIPLGTLRDWEQGRSEPDQPARAYLKIIAVDPEGTAAAL
R
>2ppx-a1-m4-cA (length=61) [Search sequence]
PRIKIIRRALKLTQEEFSARYHIPLGTLRDWEQGRSEPDQPARAYLKIIAVDPEGTAAAL
R
Structure information
PDB ID 2ppx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a HTH XRE-family like protein from Agrobacterium tumefaciens
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID A A
UniProt accession A9CIQ1 A9CIQ1
Species 176299 (Agrobacterium fabrum str. C58) 176299 (Agrobacterium fabrum str. C58)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2ppx-a1-m2-cA_2ppx-a1-m4-cA.pdb.gz
Full biological assembly
Download: 2ppx-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2ppx/1/3:A/4:A 2ppx/1/1:A/2:A
  • [Back to Home]