2prx/1/1:A/1:B

Sequences

>2prx-a1-m1-cA (length=110) [Search sequence]

FQDAYSHCYGLKSYWRGEQTIAHFPKPFHTAIPGFVYGGLIASLIDCHGTGSASAAAQPR FVTAALNIDYLAPTPGVELELVGEIKEVRKVVVEIALSALCARGHVAVKP

>2prx-a1-m1-cB (length=110) [Search sequence]

FQDAYSHCYGLKSYWRGEQTIAHFPKPFHTAPGFVYGGLIASLIDCHGTGSASAAAQRPR FVTAALNIDYLAPTPGVELELVGEIKEVRKVVVEIALSALCARGHVAVKP

Structure information

PDB ID	2prx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Thioesterase superfamily protein (ZP_00837258.1) from Shewanella loihica PV-4 at 1.65 A resolution
Assembly ID	1
Resolution	1.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	72
Sequence identity between the two chains	0.991

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	A3QJH3	A3QJH3
Species	323850 (Shewanella loihica PV-4)	323850 (Shewanella loihica PV-4)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2prx-a1-m1-cA_2prx-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2prx-assembly1.cif.gz