2psy/2/1:B/1:A

Sequences
>2psy-a2-m1-cB (length=2) [Search sequence]
LL
>2psy-a2-m1-cA (length=227) [Search sequence]
IINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPV
YESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCL
VSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSG
GPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Structure information
PDB ID 2psy (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Human Kallikrein 5 in complex with Leupeptin and Zinc
Assembly ID 2
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 11
Sequence identity between the two chains 1.0
PubMed citation 17881000
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q9Y337
Species 66430 (Streptomyces roseus) 9606 (Homo sapiens)
Function annotation BioLiP:2psyA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2psy-a2-m1-cB_2psy-a2-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2psy-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2psx/1/1:B/1:A 2psy/1/1:B/1:A

[Back to Home]