2pv2/2/1:C/1:D

Sequences
>2pv2-a2-m1-cC (length=103) [Search sequence]
TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQM
GWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLR
>2pv2-a2-m1-cD (length=103) [Search sequence]
TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQM
GWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLR
Structure information
PDB ID 2pv2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystallographic Structure of SurA first peptidyl-prolyl isomerase domain complexed with peptide NFTLKFWDIFRK
Assembly ID 2
Resolution 1.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 31
Sequence identity between the two chains 1.0
PubMed citation 17825319
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession P0ABZ6 P0ABZ6
Species 562 (Escherichia coli) 562 (Escherichia coli)
Function annotation BioLiP:2pv2C BioLiP:2pv2D
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2pv2-a2-m1-cC_2pv2-a2-m1-cD.pdb.gz
Full biological assembly
Download: 2pv2-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1m5y/1/4:B/1:A 1m5y/1/1:A/2:D 1m5y/1/3:C/4:B
  • [Back to Home]