2q0t/1/1:B/1:C

Sequences

>2q0t-a1-m1-cB (length=247) [Search sequence]

PQPDPSRLRDELVRLHGKASPEWDSLVRLDPRFVDAYLKFAGVPQRRNHLDDKTRAFIAL
AADACATQLYAPGVARHIERALSFGATREELIEVLELVSTIGIHTSNVGVPVLLEVLEEE
GLRKGAPPLDERRQKLKAEFETNRGYWHPTWEGLLELDPDLFEAYVEFSSVPWRTGVLSP
KIKEFYCAFDASATHLYVPGLKLHIRNALRYGATAEELELLEIVSVTGIHGAELGAPLLE
AALKRSG

>2q0t-a1-m1-cC (length=247) [Search sequence]

Structure information

PDB ID	2q0t (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a putative gamma-carboxymuconolactone decarboxylase subunit (bxe_b0980) from burkholderia xenovorans lb400 at 1.70 A resolution
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	157
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	Q13LR5	Q13LR5
Species	266265 (Paraburkholderia xenovorans LB400)	266265 (Paraburkholderia xenovorans LB400)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2q0t-a1-m1-cB_2q0t-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2q0t-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2q0t/1/1:B/1:A 2q0t/1/1:C/1:A