2q2k/1/2:B/2:A

Sequences
>2q2k-a1-m2-cB (length=44) [Search sequence]
KETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEI
>2q2k-a1-m2-cA (length=45) [Search sequence]
KETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEIG
Structure information
PDB ID 2q2k (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of nucleic-acid binding protein
Assembly ID 1
Resolution 3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 105
Sequence identity between the two chains 1.0
PubMed citation 18097417
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B A
UniProt accession O87365 O87365
Species 1280 (Staphylococcus aureus) 1280 (Staphylococcus aureus)
Function annotation BioLiP:2q2kB BioLiP:2q2kA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2q2k-a1-m2-cB_2q2k-a1-m2-cA.pdb.gz
Full biological assembly
Download: 2q2k-assembly1.cif.gz
Similar dimers

[Back to Home]