2q3p/1/1:A/2:A

Sequences
>2q3p-a1-m1-cA (length=102) [Search sequence]
PVKHVLLASFKDGVSPEKIEELIKGYANLVNLIEPKAFHWGKDVSIENLHQGYTHIFEST
FESKEAVAEYIAHPAHVEFATIFLGSLDKVLVIDYKPTSVSL
>2q3p-a1-m2-cA (length=102) [Search sequence]
PVKHVLLASFKDGVSPEKIEELIKGYANLVNLIEPKAFHWGKDVSIENLHQGYTHIFEST
FESKEAVAEYIAHPAHVEFATIFLGSLDKVLVIDYKPTSVSL
Structure information
PDB ID 2q3p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Ensemble refinement of the protein crystal structure of At3g17210 from Arabidopsis thaliana
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 100
Sequence identity between the two chains 1.0
PubMed citation 17850744
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q9LUV2 Q9LUV2
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
Function annotation BioLiP:2q3pA BioLiP:2q3pA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2q3p-a1-m1-cA_2q3p-a1-m2-cA.pdb.gz
Full biological assembly
Download: 2q3p-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1q4r/1/1:A/2:A 1q53/1/1:A/1:B

[Back to Home]