2q3v/1/1:A/2:B

Sequences

>2q3v-a1-m1-cA (length=89) [Search sequence]

KKNRIQVSNTKKPLFFYVNLAKRYQQYNDVELSALGAIATVVTVTEILKNNGFAVEKKIT SIVDIKPVQKAKIEITLVKSEKFDELAAA

>2q3v-a1-m2-cB (length=99) [Search sequence]

KNRIQVSNTKKPLFFYVNLAKRYQQYNDVELSALGAIATVVTVTEILKNNGFAVEKKITS IVDIKDDARGRPVQKAKIEITLVKSEKFDELAAANEEKE

Structure information

PDB ID	2q3v (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At2g34160
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	18
Sequence identity between the two chains	0.989

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	B
UniProt accession	O22969	O22969
Species	3702 (Arabidopsis thaliana)	3702 (Arabidopsis thaliana)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2q3v-a1-m1-cA_2q3v-a1-m2-cB.pdb.gz

Full biological assembly Download: 2q3v-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1vm0/1/1:A/2:B 1vm0/1/2:A/1:B 2q3v/1/2:A/1:B
Other dimers with similar sequences but different poses	2q3v/2/1:A/1:B 1vm0/1/1:A/1:B 1vm0/1/2:A/2:B 2q3v/1/1:A/1:B 2q3v/1/2:A/2:B 2q3v/1/1:B/2:B 1vm0/1/1:A/2:A 1vm0/1/1:B/2:B 2q3v/1/1:A/2:A