2q3v/2/1:A/1:B

Sequences
>2q3v-a2-m1-cA (length=89) [Search sequence]
KKNRIQVSNTKKPLFFYVNLAKRYQQYNDVELSALGAIATVVTVTEILKNNGFAVEKKIT
SIVDIKPVQKAKIEITLVKSEKFDELAAA
>2q3v-a2-m1-cB (length=99) [Search sequence]
KNRIQVSNTKKPLFFYVNLAKRYQQYNDVELSALGAIATVVTVTEILKNNGFAVEKKITS
IVDIKDDARGRPVQKAKIEITLVKSEKFDELAAANEEKE
Structure information
PDB ID 2q3v (database links: RCSB PDB PDBe PDBj PDBsum)
Title Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At2g34160
Assembly ID 2
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 0.989
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession O22969 O22969
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2q3v-a2-m1-cA_2q3v-a2-m1-cB.pdb.gz
Full biological assembly
Download: 2q3v-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1vm0/1/1:A/1:B 1vm0/1/2:A/2:B 2q3v/1/1:A/1:B 2q3v/1/2:A/2:B
Other dimers with similar sequences but different poses
  • 2q3v/1/1:B/2:B 1vm0/1/1:A/2:A 1vm0/1/1:B/2:B 2q3v/1/1:A/2:A
  • 2q3v/1/1:A/2:B 1vm0/1/1:A/2:B 1vm0/1/2:A/1:B 2q3v/1/2:A/1:B
  • [Back to Home]