2q47/2/2:A/3:B

Sequences
>2q47-a2-m2-cA (length=148) [Search sequence]
HLIPPLNFSVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLF
QFGIEGNKEPFVNIPDHKIRALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLT
SIFDEYQRFAAAKARVSDQRFEIFDVSS
>2q47-a2-m3-cB (length=148) [Search sequence]
HLIPPLNFSVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLF
QFGIEGNKEPFVNIPDHKIRALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLT
SIFDEYQRFAAAKARVSDQRFEIFDVSS
Structure information
PDB ID 2q47 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Ensemble refinement of the protein crystal structure of a putative phosphoprotein phosphatase from Arabidopsis thaliana gene At1g05000
Assembly ID 2
Resolution 3.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A B
UniProt accession Q9ZVN4 Q9ZVN4
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2q47-a2-m2-cA_2q47-a2-m3-cB.pdb.gz
Full biological assembly
Download: 2q47-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1xri/2/1:A/2:B 1xri/2/1:B/3:A 1xri/2/2:A/3:B 2q47/2/1:A/2:B 2q47/2/1:B/3:A
Other dimers with similar sequences but different poses
  • 2q47/2/3:A/3:B 1xri/1/1:A/1:B 1xri/2/1:A/1:B 1xri/2/2:A/2:B 1xri/2/3:A/3:B 2q47/1/1:A/1:B 2q47/2/1:A/1:B 2q47/2/2:A/2:B
  • 1xri/2/2:B/3:B 1xri/2/1:A/2:A 1xri/2/1:A/3:A 1xri/2/1:B/2:B 1xri/2/1:B/3:B 1xri/2/2:A/3:A 2q47/2/1:A/2:A 2q47/2/1:A/3:A 2q47/2/1:B/2:B 2q47/2/1:B/3:B 2q47/2/2:A/3:A 2q47/2/2:B/3:B
    		•

    [Back to Home]