2q4z/1/1:A/1:B

Sequences

>2q4z-a1-m1-cA (length=300) [Search sequence]

CVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRY
IDCDLNRVFDLENLSKESEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNGCTL
ILGDSGNDFLIQFHYIKTCAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLR
ADILDQRRLKHALDFIQRFNEGKEFPPCAIDVYKIEKVDYPRNESGDVAAVIHPNLQDQD
WKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRST

>2q4z-a1-m1-cB (length=300) [Search sequence]

Structure information

PDB ID	2q4z (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Ensemble refinement of the protein crystal structure of an aspartoacylase from Rattus norvegicus
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	79
Sequence identity between the two chains	1.0
PubMed citation	17850744

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q9R1T5	Q9R1T5
Species	10116 (Rattus norvegicus)	10116 (Rattus norvegicus)
Function annotation	BioLiP:2q4zB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2q4z-a1-m1-cA_2q4z-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2q4z-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2gu2/1/1:A/1:B 2gu2/2/1:A/1:B 2gu2/2/2:A/2:B