2q5z/1/2:A/2:B

Sequences

>2q5z-a1-m2-cA (length=93) [Search sequence]

HMKLSELQSHIKEFDYAPEQSEHYFFKLIEEVGELSESIRKGKSGQPTLDELKGSVAEEL YDVLYYVCALANIHGVNLEKTRELKEVLNKVKY

>2q5z-a1-m2-cB (length=94) [Search sequence]

MKLSELQSHIKEFDYAPEQSEHYFFKLIEEVGELSESIRKGKSGQPTLDELKGSVAEELY DVLYYVCALANIHGVNLEKTRELKEVLNKVKYNR

Structure information

PDB ID	2q5z (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of iMazG from Vibrio DAT 722: Ntag-iMazG (P43212)
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	137
Sequence identity between the two chains	0.989
PubMed citation	17892463

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	B
UniProt accession	Q2F9Z1	Q2F9Z1
Species	344879 (Vibrio sp. DAT722)	344879 (Vibrio sp. DAT722)
Function annotation	BioLiP:2q5zA	BioLiP:2q5zB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2q5z-a1-m2-cA_2q5z-a1-m2-cB.pdb.gz

Full biological assembly Download: 2q5z-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2q5z/1/1:A/1:B 2q73/1/1:B/1:A 2q73/1/1:D/1:C 2q9l/1/1:A/1:B 2q9l/1/1:D/1:C
Other dimers with similar sequences but different poses	2q9l/1/1:D/1:B 2q5z/1/1:A/2:B 2q5z/1/2:A/1:B 2q73/1/1:A/1:C 2q73/1/1:D/1:B 2q9l/1/1:C/1:A