2q6q/1/1:A/1:B

Sequences
>2q6q-a1-m1-cA (length=62) [Search sequence]
QQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISDLEKKLS
DA
>2q6q-a1-m1-cB (length=65) [Search sequence]
QQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISDLEKKLS
DANST
Structure information
PDB ID 2q6q (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Spc42p, a critical component of spindle pole body in budding yeast
Assembly ID 1
Resolution 1.97Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 89
Sequence identity between the two chains 1.0
PubMed citation 18850724
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P36094 P36094
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
Function annotation BioLiP:2q6qA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2q6q-a1-m1-cA_2q6q-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2q6q-assembly1.cif.gz

[Back to Home]