2q78/5/1:G/1:H

Sequences
>2q78-a5-m1-cG (length=126) [Search sequence]
HDFDFLEGKRLTEDVALDETVWNEDIELDLHLVATSALIGVVHRVSYELLSRYLPNDYTA
VVVETLARHVKAVPTGTRVAVGVRVVGVVGNRVKFRGIVSGDEKILEAEFVRAIVPREKL
RRLALE
>2q78-a5-m1-cH (length=126) [Search sequence]
HDFDFLEGKRLTEDVALDETVWNEDIELDLHLVATSALIGVVHRVSYELLSRYLPNDYTA
VVVETLARHVKAVPTGTRVAVGVRVVGVVGNRVKFRGIVSGDEKILEAEFVRAIVPREKL
RRLALE
Structure information
PDB ID 2q78 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a thioesterase-like protein (tm0581) from thermotoga maritima msb8 at 2.20 A resolution
Assembly ID 5
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 93
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G H
UniProt accession Q9WZ50 Q9WZ50
Species 243274 (Thermotoga maritima MSB8) 243274 (Thermotoga maritima MSB8)
Function annotation BioLiP:2q78G BioLiP:2q78H
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2q78-a5-m1-cG_2q78-a5-m1-cH.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2q78-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2q78/1/1:B/1:A 2q78/2/1:D/1:C 2q78/3/1:E/1:F 2q78/4/1:G/1:H 2q78/5/1:B/1:A 2q78/5/1:D/1:C 2q78/5/1:E/1:F
Other dimers with similar sequences but different poses
  • 2q78/5/1:B/1:H 2q78/5/1:C/1:A 2q78/5/1:E/1:G
  • [Back to Home]