2q79/1/1:A/2:A

Sequences
>2q79-a1-m1-cA (length=74) [Search sequence]
TTPIVHLKGDANTLKCLRYRFKKHCTLYTAVSSTWHWTKSAIVTLTYDSEWQRDQFLSQV
KIPKTITVSTGFMS
>2q79-a1-m2-cA (length=74) [Search sequence]
TTPIVHLKGDANTLKCLRYRFKKHCTLYTAVSSTWHWTKSAIVTLTYDSEWQRDQFLSQV
KIPKTITVSTGFMS
Structure information
PDB ID 2q79 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of single chain E2C from HPV16 with a 12aa linker for monomerization.
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 50
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P03120 P03120
Species 333760 (Human papillomavirus type 16) 333760 (Human papillomavirus type 16)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2q79-a1-m1-cA_2q79-a1-m2-cA.pdb.gz
Full biological assembly
Download: 2q79-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1by9/1/1:A/2:A 1r8p/1/1:A/1:B 1zzf/1/1:A/1:B 3mi7/1/1:X/2:X

[Back to Home]