2q8r/2/1:F/1:G

Sequences

>2q8r-a2-m1-cF (length=63) [Search sequence]

GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYI KDM

>2q8r-a2-m1-cG (length=63) [Search sequence]

GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYI KDM

Structure information

PDB ID	2q8r (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural and Functional Characterization of CC Chemokine CCL14
Assembly ID	2
Resolution	1.82Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	62
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	G
UniProt accession	Q16627	Q16627
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2q8r-a2-m1-cF_2q8r-a2-m1-cG.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2q8r-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2q8r/1/1:H/1:E 2q8t/1/1:A/1:B 2q8t/2/1:D/1:C