2qbu/1/1:A/1:B

Sequences

>2qbu-a1-m1-cA (length=228) [Search sequence]

MHGKLIGVGVGPGDSELLTLRAVNVLRSVPVICAPRSSSERESIALSIVEDILTERRDGC
RILDPVFPMTDDRDELESHWDSAARMVAAELEDGRDVAFITLGDPSIYSTFSYLQQRIED
MGFKTEMVPGVTSFTACAATAGRTLVEGDEILLVVPRVDDRFERVLRDVDACVIMKTSRH
GRRAMEVVESDPRGKDVVSVANCSMDDEVVERGFASGGGYLATTLVRF

>2qbu-a1-m1-cB (length=228) [Search sequence]

Structure information

PDB ID	2qbu (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Methanothermobacter thermautotrophicus CbiL
Assembly ID	1
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	175
Sequence identity between the two chains	1.0
PubMed citation	17567575

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O27402	O27402
Species	187420 (Methanothermobacter thermautotrophicus str. Delta H)	187420 (Methanothermobacter thermautotrophicus str. Delta H)
Function annotation	BioLiP:2qbuA	BioLiP:2qbuB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2qbu-a1-m1-cA_2qbu-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2qbu-assembly1.cif.gz