2qdo/2/1:B/1:A

Sequences
>2qdo-a2-m1-cB (length=52) [Search sequence]
DLSFEQEFQMRVMEEQVSAMSLQEARELLLQASRLLMMKDNVIRSLVKRAAR
>2qdo-a2-m1-cA (length=53) [Search sequence]
VDLSFEQEFQMRVMEEQVSAMSLQEARELLLQASRLLMMKDNVIRSLVKRAAR
Structure information
PDB ID 2qdo (database links: RCSB PDB PDBe PDBj PDBsum)
Title NblA protein from T. vulcanus
Assembly ID 2
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 98
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession A7LBW5 A7LBW5
Species 455064 (Thermostichus vulcanus str. Copeland) 455064 (Thermostichus vulcanus str. Copeland)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2qdo-a2-m1-cB_2qdo-a2-m1-cA.pdb.gz
Full biological assembly
Download: 2qdo-assembly2.cif.gz
Similar dimers

[Back to Home]