2ql2/3/1:D/1:B

Sequences
>2ql2-a3-m1-cD (length=57) [Search sequence]
RRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILR
>2ql2-a3-m1-cB (length=59) [Search sequence]
SRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRS
Structure information
PDB ID 2ql2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the basic-helix-loop-helix domains of the heterodimer E47/NeuroD1 bound to DNA
Assembly ID 3
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 23
Sequence identity between the two chains 1.0
PubMed citation 18069799
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D B
UniProt accession Q60867 Q60867
Species 10090 (Mus musculus) 10090 (Mus musculus)
Function annotation BioLiP:2ql2D BioLiP:2ql2B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ql2-a3-m1-cD_2ql2-a3-m1-cB.pdb.gz
Full biological assembly
Download: 2ql2-assembly3.cif.gz

[Back to Home]