2qms/2/1:B/2:D

Sequences
>2qms-a2-m1-cB (length=113) [Search sequence]
SLSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKH
YLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL
>2qms-a2-m2-cD (length=113) [Search sequence]
SLSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKH
YLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL
Structure information
PDB ID 2qms (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a signaling molecule
Assembly ID 2
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 79
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B D
UniProt accession Q14451 Q14451
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2qms-a2-m1-cB_2qms-a2-m2-cD.pdb.gz
Full biological assembly
Download: 2qms-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 7mp3/1/1:B/1:A 2qms/3/1:A/1:B 2qms/4/1:C/1:D 5tyi/1/1:A/1:B 5tyi/2/1:D/1:C 5u06/1/1:B/1:A 5u06/2/1:D/1:C 5u1q/1/1:A/1:B 5u1q/2/1:D/1:C
  • [Back to Home]