2qqy/1/7:A/9:A

Sequences
>2qqy-a1-m7-cA (length=133) [Search sequence]
SHDVKELIEGLNEDLAGEYSAIIYNHNAATVSGIYRQVLKPFFESEISDEQGHALYLAEK
IKTLGGTPTTIPLRVKQAEDVRELEYARQSEYETIKRYEKRKEQAANLNTELVVKLEDIA
DETNHEELDRLLN
>2qqy-a1-m9-cA (length=133) [Search sequence]
SHDVKELIEGLNEDLAGEYSAIIYNHNAATVSGIYRQVLKPFFESEISDEQGHALYLAEK
IKTLGGTPTTIPLRVKQAEDVRELEYARQSEYETIKRYEKRKEQAANLNTELVVKLEDIA
DETNHEELDRLLN
Structure information
PDB ID 2qqy (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of ferritin like, diiron-carboxylate proteins from Bacillus anthracis str. Ames
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 7 9
Chain ID A A
UniProt accession Q9K5J5 Q9K5J5
Species 198094 (Bacillus anthracis str. Ames) 198094 (Bacillus anthracis str. Ames)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2qqy-a1-m7-cA_2qqy-a1-m9-cA.pdb.gz
Full biological assembly
Download: 2qqy-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2qqy/1/10:A/2:A 2qqy/1/10:A/6:A 2qqy/1/11:A/8:A 2qqy/1/12:A/3:A 2qqy/1/12:A/5:A 2qqy/1/1:A/11:A 2qqy/1/1:A/8:A 2qqy/1/2:A/6:A 2qqy/1/3:A/5:A 2qqy/1/4:A/7:A 2qqy/1/4:A/9:A
Other dimers with similar sequences but different poses
  • 2qqy/1/11:A/9:A 2qqy/1/10:A/12:A 2qqy/1/1:A/3:A 2qqy/1/2:A/4:A 2qqy/1/5:A/7:A 2qqy/1/6:A/8:A
  • 2qqy/1/5:A/9:A 2qqy/1/10:A/3:A 2qqy/1/10:A/8:A 2qqy/1/11:A/4:A 2qqy/1/11:A/6:A 2qqy/1/12:A/2:A 2qqy/1/12:A/7:A 2qqy/1/1:A/5:A 2qqy/1/1:A/9:A 2qqy/1/2:A/7:A 2qqy/1/3:A/8:A 2qqy/1/4:A/6:A
  • [Back to Home]