2qrw/8/1:A/1:L

Sequences
>2qrw-a8-m1-cA (length=126) [Search sequence]
KSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTY
SEQRGHPRLRMRHAPFRISLIERDAFLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHS
LVNSPF
>2qrw-a8-m1-cL (length=126) [Search sequence]
KSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTY
SEQRGHPRLRMRHAPFRISLIERDAFLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHS
LVNSPF
Structure information
PDB ID 2qrw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Mycobacterium tuberculosis trHbO WG8F mutant
Assembly ID 8
Resolution 1.93Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 17
Sequence identity between the two chains 1.0
PubMed citation 17887774
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A L
UniProt accession P9WN23 P9WN23
Species 1773 (Mycobacterium tuberculosis) 1773 (Mycobacterium tuberculosis)
Function annotation BioLiP:2qrwA BioLiP:2qrwL
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2qrw-a8-m1-cA_2qrw-a8-m1-cL.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2qrw-assembly8.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1ngk/1/1:A/1:L 1ngk/1/1:B/1:J 1ngk/1/1:C/1:K 1ngk/1/1:D/1:G 1ngk/1/1:E/1:H 1ngk/1/1:F/1:I 2qrw/7/1:E/1:H 2qrw/7/1:J/1:B 2qrw/8/1:D/1:G 2qrw/9/1:C/1:K 2qrw/9/1:F/1:I
Other dimers with similar sequences but different poses
  • 2qrw/7/1:B/1:H 1ngk/1/1:A/1:G 1ngk/1/1:B/1:H 1ngk/1/1:C/1:I 1ngk/1/1:D/1:L 1ngk/1/1:E/1:J 1ngk/1/1:F/1:K 2qrw/1/1:B/1:H 2qrw/2/1:A/1:G 2qrw/3/1:C/1:I 2qrw/4/1:D/1:L 2qrw/5/1:E/1:J 2qrw/6/1:F/1:K 2qrw/7/1:E/1:J 2qrw/8/1:A/1:G 2qrw/8/1:D/1:L 2qrw/9/1:C/1:I 2qrw/9/1:F/1:K
  • 1ngk/1/1:E/1:L 1ngk/1/1:A/1:H 1ngk/1/1:B/1:I 1ngk/1/1:C/1:G 1ngk/1/1:D/1:K 1ngk/1/1:F/1:J
  • 1ngk/1/1:A/1:D 1ngk/1/1:B/1:E 1ngk/1/1:C/1:F 2qrw/7/1:E/1:B 2qrw/8/1:A/1:D 2qrw/9/1:F/1:C
  • 1ngk/1/1:G/1:K 1ngk/1/1:H/1:L 1ngk/1/1:I/1:J
    		•

    [Back to Home]