2qsq/1/1:B/1:A

Sequences
>2qsq-a1-m1-cB (length=109) [Search sequence]
AKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGP
AYSGREIIYPNASLLIQNIIQNDAGFYTLHVIKSDLVNEEATGQFRVYP
>2qsq-a1-m1-cA (length=111) [Search sequence]
AKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGP
AYSGREIIYPNASLLIQNIIQNDAGFYTLHVIKSDLVNEEATGQFRVYPEL
Structure information
PDB ID 2qsq (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the N-terminal domain of carcinoembryonic antigen (CEA)
Assembly ID 1
Resolution 1.95Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 59
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P06731 P06731
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2qsq-a1-m1-cB_2qsq-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2qsq-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2qst/1/1:A/2:A 2qst/2/1:B/3:B

[Back to Home]