2qyc/2/2:A/2:B

Sequences
>2qyc-a2-m2-cA (length=95) [Search sequence]
GTFLHVVEFDDGIDAGFFRTVDEYVARKRECDGLLLYHFGENVAARSQGYTHATSSAFVD
AAAHDAYQVCPAHVAKAFGPRIKRVVVYDGEVPAI
>2qyc-a2-m2-cB (length=95) [Search sequence]
GTFLHVVEFDDGIDAGFFRTVDEYVARKRECDGLLLYHFGENVAARSQGYTHATSSAFVD
AAAHDAYQVCPAHVAKAFGPRIKRVVVYDGEVPAI
Structure information
PDB ID 2qyc (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a dimeric ferredoxin-like protein (bb1511) from bordetella bronchiseptica rb50 at 1.90 A resolution
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 82
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession A0A0H3LJT0 A0A0H3LJT0
Species 257310 (Bordetella bronchiseptica RB50) 257310 (Bordetella bronchiseptica RB50)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2qyc-a2-m2-cA_2qyc-a2-m2-cB.pdb.gz
Full biological assembly
Download: 2qyc-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2qyc/1/1:A/1:B 2qyc/2/1:A/1:B
Other dimers with similar sequences but different poses
  • 2qyc/2/1:A/2:B 2qyc/2/1:B/2:A
  • [Back to Home]